We have partnered with TradePub to bring you free industry magazines and resources - no coupons or credit cards required!

Visit: englishforums.tradepub.com


1 2 3
Share this topic:
Anonymous, 3 yr 363 days ago
Longest name of a place:

1. The official name of Bangkok, Thailand: Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit

Translation:

krungthep mahanakorn
The great city of angels,

amorn rattanakosin mahintara yutthaya mahadilok phop
the supreme unconqueralble land of the great immortal divinity (Indra),

noparat rajathani burirom
the royal capital of nine noble gems, the pleasant city,

udomrajaniwes mahasatharn
with plenty of grand royal palaces,

amorn phimarn avatarnsathit
and divine paradises for the reincarnated deity (Vishnu),

sakkatattiya visanukam prasit
given by Indra and created by the god of crafting (Visnukarma).

2. Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu  (New Zealand's South Island)

Translation: "The place where Tamatea, the man with the big knees, who slid, climbed, and swallowed mountains, known as land eater, played his flute to his loved one"

3.
Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch (North Wales)

Translation: "
Saint Mary's Church in the hollow of white hazel near a rapid whirlpool and the Church of Saint Tysilio near the red cave."

Apparently
http://llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk/ is the longest domain name on the web. Locals call it Llanfair PG or Llanfairpwll.

=======================

Shortest name of a place:

1. A (Norway)

It's actually A with a circle on top, pronounced like 'or' in 'port'. It's an old Norwegian word for river, and the last alphabet in Norwegian. It's
a tiny fishing hamlet in the Lofoten Islands.

2. Y (France)

Pronounced as E. Y is near the township of Ham ans Athies in the department of Somme in Picardy.
YoHf, 3 yr 363 days ago
Why such a long name I ask... Stick out tongue [:P]
Anonymous, 3 yr 154 days ago
How about "The United Kingdom of Great Britain and Northern Ireland" at 48 letters
Hemavich  +  414434 Wed, 05 Sep 07 10:03 AM

"UNITED ARAB EMIRATES" is the longest name of a country consisting of alternating vowels and consonants.

Joined on Sat, Mar 3 2007
Egypt مصر エジプト Ägypten मिस् Mısır 埃及 Еги́пет מצרים
Full Member 204
" 8-| True knowledge exists in knowing that you know nothing :^) "
Neeraj Jain, 2 yr 70 days ago
Hey Deepa, Leh is not in Sikkim. It is in Jammu and Kashmir, India.
Anonymous, 2 yr 68 days ago
do you know the longest name of a country, that alternates consanents and vowels?
Anonymous, 2 yr 34 days ago
I'd like to correct some lilttle mistake.
"Krungthep Mahanakorn Amornratanakosin Mahintarayutthaya Mahadilokphop Nopparatrajathani Burirom Udomrajaniwes Mahasatharna Amornphimarn Avatarnsathit Sakkattiya Visanukamprasit"
If you are not Thai and you could find these info of Bangkok, you are so good!!
Anonymous, 361 days ago
guiness book of records has bangcocks real name as Krung Thep Mahanakhon Amon Rattanakosin Mahinthara Yuthaya Mahadilok Phop Noppharat Ratchathani Burirom Udomratchaniwet Mahasathan Amon Piman Awatan Sathit Sakkathattiya Witsanukam Prasit.
Anonymous, 338 days ago
How can the "english" forum not include
The united Kingdom of Great Britain and Northern Ireland
49 Letters
1 2 3
© MediaCet Ltd. 2009, v5.0.3607.32596. All content posted by our users is a contribution to the public domain, this does not include imported usenet posts.*
For web related enquires please contact us on webmaster@mediacet.com, status updates are available at status.mediacet.com.
*Usenet post removal: Use 'X-No-Archive'. You may not have understood that your posts would end up in the public domain. Please send proof of the poster's email, we will remove immediately.