Learn English and meet people on the world’s largest EFL social network

We have partnered with TradePub to bring you free industry magazines and resources - no coupons or credit cards required!

Visit: englishforums.tradepub.com


1 « 25 26 27 28 29 30 31 32
Share this topic:
seyfihoca  +  69210 Sat, 22 Jan 05 10:30 AM
has anyone suggested

Gorsafawddacha'idraigodanheddogleddollônpenrhynareurdraethceredigion

The longest station name in the UK
Joined on Thu, Jan 20 2005
Turkey/Eskisehir
Full Member 109
Dil Sınavlarına Hazırlık Merkezi
seyfihoca  +  69211 Sat, 22 Jan 05 10:31 AM

and to sum up:

THE LONGEST WORDS IN ENGLISH

• According to the Guinness Book of World Records, 18th edition, the following word is the longest chemical word for C1289H2051N343O375S8. Methionylglutaminy...serine is a scientific name for tryptophan synthetase, which is made up of 267 amino acids. It has appeared written down a number of times and has 1,909 letters.
The full name is:
methionylglutaminylarginyltyrosylglutamylserylleucylphenylalanylalanylglutaminylleucyllysylglutamylarginy

llysylglutamylglycylalanylphenylalanylvalyl

prolylphenylalanylvalylthreonylleucylglycylaspartylprolylglycylisoleucylglutamylglutaminylserylleucyllysyl

isoleucylaspartylthreonylleucylisoleucylglutamylalanylglycylalanylaspartylalanylleucylglutamylleucylglycyl

isoleucylprolylphenylalanylserylaspartylprolylleucylalanylaspartylglycylprolylthreonylisoleucylglutaminyla

sparaginylalanylthreonylleucylarginylalanylphenylalanylalanylalanylglycylvalylthreonylprolylalanylglutamin

ylcysteinylphenylalanylglutamylmethionylleucylalanylleucylisoleucylarginylglutaminyllysylhistidylprolylthre

onylisoleucylprolylisoleucylglycylleucylleucylmethionyltyrosylalanylasparaginylleucylvalylphenylalanylasp

araginyllysylglycylisoleucylaspartylglutamylphenylalanyltyrosylalanylglutaminylcysteinylglutamyllysylvalyl

glycylvalylaspartylserylvalylleucylvalylalanylaspartylvalylprolylvalylglutaminylglutamylserylalanylprolylph

enylalanylarginylglutaminylalanylalanylleucylarginylhistidylasparaginylvalylalanylprolylisoleucylphenylala

nylisoleucylcysteinylprolylprolylaspartylalanylaspartylaspartylaspartylleucylleucylarginylglutaminylisoleu

cylalanylseryltyrosylglycylarginylglycyltyrosylthreonyltyrosylleucylleucylserylarginylalanylglycylvalylthre

onylglycylalanylglutamylasparaginylarginylalanylalanylleucylprolylleucylasparaginylhistidylleucylvalylala

nyllysylleucyllysylglutamyltyrosylasparaginylalanylalanylprolylprolylleucylglutaminylglycylphenylalanylg

lycylisoleucylserylalanylprolylaspartylglutaminylvalyllysylalanylalanylisoleucylaspartylalanylglycylalanyla

lanylglycylalanylisoleucylserylglycylserylalanylisoleucylvalyllysylisoleucylisoleucylglutamylglutaminylhisti

dylasparaginylisoleucylglutamylprolylglutamyllysylmethionylleucylalanylalanylleucyllysylvalylphenylalany

lvalylglutaminylprolylmethionyllysylalanylalanylthreonylarginylserine

• pneumonoultramicroscopicsilicovolcanoconiosis (a lung disease caused by the inhalation of
• Honorificabilitudinitatibus
• Supercalifragilisticexpialidocious
• contraneoantidisestablishmentarianalistically
• The technical term for "Tobacco Mosaic Virus, Dahlemense Strain" is the current official longest word:
• Antidisestablishmentarianism (a movement opposed to the separation of church and state)
o -disestablishment- - the separation of Church and State (specifically in this context it is the political movement of the 1860s in Great Britain)
o disestablishment-arian - a person in support of the movement designed to bring about the above (hereafter called the 'first' movement).
o anti-disestablishment-arian - a person belonging to the movement opposed to the first movement.
o neo-anti-disestablishment-arian - a person belonging to the new version of the movement opposed to the first movement. (Appropriate because in this context the original antidisestablishment movement had become defunct).
o contra-neo-anti-disestablishment-arian - a person belonging to the movement opposed to the new version of the movement opposed to the first movement.
o contra-neo-anti-disestablishment-arian-alistically - behaving in the manner of a person belonging to the movement opposed to the new version of the movement opposed to the first movement.
o pseudo-contra-neo-anti-disestablishment-arian-alistically - false behaviour in the manner of a person belonging to the movement opposed to the new version of the movement opposed to the first movement.
o pro-pseudo-contra-neo-anti-disestablishment-arian-alistically - in favour of the false behaviour in the manner of a person belonging to the movement opposed to the new version of the movement opposed to the first movement.
• Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwhenuakitanatahu (85 letters) which is a hill in New Zealand.
• Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch is the famous name of a town in Wales in the United Kingdom.
• The longest station name in the UK, at 68 letters, is: Gorsafawddacha'idraigodanheddogleddollônpenrhynareurdraethceredigion which was contrived to beat the Welsh Town.
• The longest place name in the United States (45 letters) is Chargoggagoggmanchauggagoggchaubunagungamaugg.
• The longest hyphenated name in the U.S. is Winchester-on-the-Severn, a town in Maryland.
• Hippopotomonstrosesquippedaliophobia - is the fear of long words (36 letters long).
• Bababadalgharaghtakamminarronnkonnbronntonnerronntuonnthunntrovarrhounawnskawntoohoohoordenenthurnuk. Appearing on the first page, it allegedly is the symbolic thunderclap representing the fall of Adam and Eve.
• "Twoallbeefpattiesspecialsaucelettucecheesepicklesonionsonasesameseedbun" was used in a McDonald's Restaurant advertisement.
• Floccinaucinihilipilification is the act or habit of esteeming or describing something as worthless, or making something to be worthless by said means.
• sesquipedalianism means "the practice of using words one and half feet long".
• otorhinolaryngological (22 letters),
immunoelectrophoretically (25 letters),
psychophysicotherapeutics (25 letters),
thyroparathyroidectomized (25 letters),
pneumoencephalographically (26 letters),
radioimmunoelectrophoresis (26 letters),
psychoneuroendocrinological (27 letters)
hepaticocholangiogastrostomy (28 letters),
spectrophotofluorometrically (28 letters),
pseudopseudohypoparathyroidism (30 letters).
• In Voltaire's Candide, Pangloss is supposed to have given lectures on metaphysico-theologo-cosmonigology (34 letters).
• Greek words, and the Latin equivalents; osteosarchaematosplanchnochondroneuromuelous (44 letters) and osseocarnisanguineoviscericartilaginonervomedullary (51 letters), which translate roughly as 'of bone, flesh, blood, organs, gristle, nerve, and marrow'.
• praetertranssubstantiationalistically (37 letters), used in Mark McShane's Untimely Ripped (1963), and aequeosalinocalcalinoceraceoaluminosocupreovitriolic (52 letters), attributed to Dr Edward Strother (1675-1737).
• The formal names of chemical compounds are almost unlimited in length (for example, aminoheptafluorocyclotetraphosphonitrile, 40 letters).
• Pneumonoultramicroscpicsilicovolcanoconiosis
• Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwe
• Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudo

mrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit
in Thailand which is a whopping 163 characters long so long that it doesn't even fit on one line! However whilst the New Zealand place name is recognised by the Guiness Book of Record, the Thailand name is not.
• fluvialgeomorphologicaldendrochronology


in turkish we have: hassasiyetsizlestiriveremeyebileceklerimizdenmisiniz

which more or less means "are you from those whom we will not be able to make sensitive to ...?

© MediaCet Ltd. 2009, v5.0.3598.39794. All content posted by our users is a contribution to the public domain, this does not include imported usenet posts.*
For web related enquires please contact us on webmaster@mediacet.com, status updates are available at status.mediacet.com.
*Usenet post removal: Use 'X-No-Archive'. You may not have understood that your posts would end up in the public domain. Please send proof of the poster's email, we will remove immediately.