The longest English word

This is a discussion thread · 106 replies
 2 3 4 5 6 7 8 9 10 12
Methionylglutaminylarginyltyrosylglutamylserylleucylphen-
ylalanylalanylglutaminylleucyllysylglutamylarginyllysylgluta-
mylglysylalanylphenylalanylvalylprolylphenylalanylyalylthre-
onylleucylglcycylaspartylprolylglicylisoleucyglutamylgluta-
minlserylleucyllysylisoleucylaspartylthreonylleucylisoleu-
cylglutamylalanylglyclyalanylaspartylalanylleucyglutamylle-
ucylgluycylisoleucylproluylphenylalanyserylaspartyprolylleu-
celalanylaspartylglycylprolylthreonylisolleucyglutaminylaspa-
raginylalanythreonylleucylarginylalanylphenylalanylalanylal-
anylglycylvalylthreonylprolylalanylglutaminylcysteinylphen-
ylalanylglglutamylmethionylleucyalanylleucylisoleucylarginyl-
glutaminyllysylhistidylprolyuthreonylisoleucylprolylisoleuc-
ylglycylleucylleucylmethionyltyrosylalanylasbaraginylleucyl-
valylphenylalanylsparaginyyllysylglycylisoleucylaspartylglut-
amylphenylalanylyltyrosylalanylglutaminylcysteinylglutamyll-
ysylvalylglycylvalylspartylserylvalylleucylvallalanylaspart-
ylvalylprolylvalvlglutaminylglutamylserylalanylprolylpheny-
lalalrginylglutaminylalanylalanylleucylarginylhistidylasp-
araginylvalylalalprolylisoleucylphenylalanylisoleucylcystei-
nylprolyprolylaspartylalanylaspartylaspartyspartyleucylle-
ucylarginylglutaminylisoleucylalanylseryltyroslglycylargin-
ylglycyltyrosylthreonyltyrosylleucylleucylserylarginlalanyl-
glycylvalylthreonylglycylalanylglutamylasparaginylarginyla-
nylalanylleucylprolylleucylaspaaginylhistidylleucylvalylalan-
yllysylleucyllysylglutamyltyrosylasparagimylalanylalanypro-
lylprolylleucylglutaminylglycylphenlalanylglycylisoleyucyls-
erylalanylprolylaspartylglutaminylvalyllysylalanylalanylisol-
eucylalspartylalanylglycylalanylalanylglycylalanylasoleucylse-
rylglycylserylalanylisoleucylbalyllysylisoleucylisoleucylgluta-
mylglutaminylhistidylasparaginylisoleucylglutamylpronylglu-0
tamyllysylmethionylluecylalanylalanyoeucyllysylvalylpheny-
lalanylvalylglutamilylprolylmethionyllysylalanylalanylthreo-
nylarginylserine.

I think this is the longest word in the world!!
New Member01
Thread is locked
This has been debated before, I don't remember if it was in this forum or elsewhere, so I will reply once again.

If you consider any protein's name in this - I'm sorry for the word - ridiculously expanded form to be an actual word, then there deifinitely exist bigger proteins (and thus words) than the one mentioned above.
However, nobody ever uses this kind of name for proteins, and as I've never seen this name form in any kind of literature (and as I am studying the subject I can speak with a fair amount of certainty), I'm seriously doubting how valid it is to call such contraptions 'words'. Emotion: wink
New Member43
Thread is locked
Guest:
..and you could always add another aminoacid in the sequence..
creating an even longer word! Emotion: crying
Thread is locked
Anonymous:
hi my name is erin and I am 12 years old (but 1 month away from being 13![<:o)])the real longest word in the world is PNEUMONO­ULTRA­MICRO­SCOPIC­SILICO­VOLCANO­CONIOSIS

meaning:

a lung disease caused by breathing in particles of siliceous volcanic dus
This is the longest word in any English dictionary. However, it was coined by Everett Smith, the President of The National Puzzlers' League, in 1935 purely for the purpose of inventing a new "longest word". The Oxford English Dictionary described the word as factitious. Nevertheless it also appears in the Webster's, Random House, and Chambers dictionaries.





and I know that

kyyhkyslakkahillotaatelipalmusunnuntaikävelykatujuhla-
koristehedelmäkaramellimassatuotevalvontalaitteisto-
testauslaboratoriokäyttökertatulitikkuviinapiilohomo-
kaasulasersädehoitokotikaljakimblemestaruussarjakuva-
ristikkokilpajuoksuhiekka-aavikkoluonto-ohjelmauusinta-
vaalikokousedustusmeno-paluuruuhkabussivuoropysäköinti-
sakkolihakoukkuselkänahkavyöruusukasvimaamunajuustomaito-
rasvaimunestepinta-alahuulipunakampelaverkkomahalasku-
harjoitustyöaamukampapellavaöljykriisiapukeinolonkkalepo-
lomarusketusrajatietoteollisuuskiinteistömarkkinointi-
diplomi-insinööriopiskelijaperinnemaisema-arkkitehti-
kilta-aktiivihiiliteräsbetonivalurautaristisiitoshärkä-
pizzamaustevoipaperiroskapostimerkkisavusaunavastaprotesti-
marssivapautusliikevaihtoväliarvojoukkopakomatkaopas-
koirakantakorttitaikatalvisotakunniajäsenetupuolikuiva-
rehuvilja-aittakorpisuomaastohiihtoputkitiivistesilikoni-
rintataskuvaraslähtöliukumiinakenttäkeitinvesihanasaari-
ryhmätyömyyrävuosikurssikirjapainopistetulotukivarsikenkä-
kauppaopistoupseerikerhohuonepalveluammattikoulupoika-
tyttöenergiatalousaluelaajennustarvehierarkiakaavio-
suunnittelupäätöspäivävientisulkuporttiteoriapohjakunto-
urheiluruutuässäpariluistelutyylituomaripelimies-
voimisteluvideokulmakarvakuonokoppalakkipäämääräalennus-
tilataksimittarimatopurkkikeittoastiakaappipakastin-
yhdistelmälukkoseppähenkilötunnussanaleikkikalupakkipussi-
eläinkoeponnistuslautakuntalakitekstiseikkailuleiri-
telttakangaspuujalkasienipiirakkareseptivihkopakkaus-
muovikuularuiskumaalaustarvikevarastohyllymetrilakuavain-
naulakkovartiopäällikkötasogeometriavirhevaihtosähkökazoo-
pillihousupukupellehyppylankakeräkaaliaivovuotosuoja-
vaatekappalemyyntitykkilavatanssiaskelmoottoripyörä-
koppisiemenperunapalstajakoviivaintegraalioperaattori-
algebraoppilaitoskompleksilukusuoraveto-oikeusmurha-
asevarikkopilttuu

is not a real word because this word is made up of a ton of litttle words i another languge and if you translate al of the little words it say stuff likekyyhkys, actually "kyyhkynen", means a dove and the next part lakka means an arctic cloudberry and the next hillo means jam so if you put the first three all together it means dovearcticcloudberryjam now if you look up the defonithion it says. . . . . . . . . . . . . . . drum roll please. . . . . . . . . . . . . . there isn't one because this is not a real word!
Thread is locked
Anonymous:
HELLO!

I think, it's not the longest word in the world.

Please, tell me, what does it mean?

Your Sincerely:Alexander Boyanov, Bulgaria
Thread is locked
Anonymous:
that is nt the longest word. the longest is 182 letters, and its greek!
Thread is locked
What about the longest one syllable word?  With a sense of irony, I propose "stretched."
New Member03
Thread is locked
Anonymous:
hi friends

i would like to know whtz the longest word in english without vowels. the word i know is RHYTHM. any one who knows a longer word is welcome to reply.
Thread is locked
Anonymous:
i think it is symphysy.I have no clue what it means though!
Thread is locked
Show more
Live chat
Registered users can join here