Search results for 'tag:Numbers tag:Longest words' matching tags 'Numbers' and 'Longest words'

Re: no

Anonymous — Tue, 28 Feb 2006 01:17:08 GMT

hey hey hey, the ongest word in the world is ......................................................

Do you remember â when you were a child â learning (then gleefully reciting) what you thought was the longest word in the English language? Was it ANTIDISESTABLISHMENTARIANISM? Or the similarly long SUPERCALIFRAGILISTICEXPIALIDOCIOUS?

There are longer ones...

However, there is no easy answer that we can give when our visitors ask us for the longest word in the English language. Most very long words only occur in one or two dictionaries, and often they are debatably not words at all. For example, ANTIDISESTABLISHMENTARIANISM has possibly never really been used to mean "the belief which opposes removing the tie between church and state." Certainly 99 in 100 times it is used as an example of a long word. And who says you can't put NONâ (for example) on the beginning to make it even longer?

This problem is even more evident in chemical names. Most chemicals are named using a systematic naming system which methodically describes the molecule's structure. Some molecules, such as proteins, are huge, so it is possible to come up with genuine words containing millions of letters. But of course no chemist uses these really long names in practice.

Here we look at some of the longest words in English dictionaries, and discuss whether they should be considered to be real words. Interesting long chemical terms and place names are listed separately afterwards. The red numbers indicate the length (number of letters) of the word that follows.

Longest Words

(45) PNEUMONOULTRAMICROSCOPICSILICOVOLCANOCONIOSIS (also spelled PNEUMONOULTRAMICROSCOPICSILICOVOLCANOKONIOSIS) = a lung disease caused by breathing in particles of siliceous volcanic dust.
This is the longest word in any English dictionary. However, it was coined by Everett Smith, the President of The National Puzzlers' League, in 1935 purely for the purpose of inventing a new "longest word". The Oxford English Dictionary described the word as factitious. Nevertheless it also appears in the Webster's, Random House, and Chambers dictionaries.

(37) HEPATICOCHOLANGIOCHOLECYSTENTEROSTOMIES = a surgical creation of a connection between the gall bladder and a hepatic duct and between the intestine and the gall bladder.
This is the longest word in Gould's Medical Dictionary.

(34) SUPERCALIFRAGILISTICEXPIALIDOCIOUS = song title from the Walt Disney movie Mary Poppins.
It is in the Oxford English Dictionary.

"But then one day I learned a word
That saved me achin' nose,
The biggest word you ever 'eard,
And this is 'ow it goes:
Supercalifragilisticexpialidocious!"

(30) HIPPOPOTOMONSTROSESQUIPEDALIAN = pertaining to a very long word.
From Mrs. Byrne's Dictionary of Unusual, Obscure and Preposterous Words.

(29) FLOCCINAUCINIHILIPILIFICATION = an estimation of something as worthless.
This is the longest word in the first edition of the Oxford English Dictionary. Interestingly the most common letter in English, E, does not appear in this word at all, whilst I occurs a total of nine times. The word dates back to 1741. The 1992 Guinness Book of World Records calls floccinaucinihilipilification the longest real word in the Oxford English Dictionary, and refers to pneumonoultramicroscopicsilicovolcanokoniosis as the longest made-up one.

(28) ANTIDISESTABLISHMENTARIANISM = the belief which opposes removing the tie between church and state.
Probably the most popular of the "longest words" in recent decades.

(27) HONORIFICABILITUDINITATIBUS = honorableness.
The word first appeared in English in 1599, and in 1721 was listed by Bailey's Dictionary as the longest word in English. It was used by Shakespeare in Love's Labor's Lost (Costard; Act V, Scene I):

"O, they have lived long on the alms-basket of words.
I marvel thy master hath not eaten thee for a word;
for thou art not so long by the head as
honorificabilitudinitatibus: thou art easier
swallowed than a flap-dragon."

Shakespeare does not use any other words over 17 letters in length.

(27) ELECTROENCEPHALOGRAPHICALLY
The longest unhyphenated word in Merriam-Webster's Collegiate Dictionary (10th Ed.), joint with ethylenediaminetetraacetate (see below).

(27) ANTITRANSUBSTANTIATIONALIST = one who doubts that consecrated bread and wine actually change into the body and blood of Christ.

(21) DISPROPORTIONABLENESS and (21) INCOMPREHENSIBILITIES
These are described by the 1992 Guinness Book of World Records as the longest words in common usage.

Some say SMILES is the longest word because there is a MILE between the first and last letters!

Chemical Terms

Two chemical terms (3,641 and 1,913 letters long) have appeared in the Guinness Book of World Records. They were withdrawn because they have never been used by chemists, and there is no theoretical limit to the length of possible legitimate chemical terms. A DNA molecule could have a name of over 1,000,000,000 letters if it was written out in full.

(1,185) ACETYLSERYLTYROSYLSERYLISOLEUCYLTHREONYLSERYLPROLYLSERYLGLUTAMINYLPHENYLALANYLVALYLPHENYLALANYLLEUCYLSERYLSERYLVALYLTRYPTOPHYLALANYLASPARTYLPROLYLISOLEUCYLGLUTAMYLLEUCYLLEUCYLASPARAGINYLVALYLCYSTEINYLTHREONYLSERYLSERYLLEUCYLGLYCYLASPARAGINYLGLUTAMINYLPHENYLALANYLGLUTAMINYLTHREONYLGLUTAMINYLGLUTAMINYLALANYLARGINYLTHREONYLTHREONYLGLUTAMINYLVALYLGLUTAMINYLGLUTAMINYLPHENYLALANYLSERYLGLUTAMINYLVALYLTRYPTOPHYLLYSYLPROLYLPHENYLALANYLPROLYLGLUTAMINYLSERYLTHREONYLVALYLARGINYLPHENYLALANYLPROLYLGLYCYLASPARTYLVALYLTYROSYLLYSYLVALYLTYROSYLARGINYLTYROSYLASPARAGINYLALANYLVALYLLEUCYLASPARTYLPROLYLLEUCYLISOLEUCYLTHREONYLALANYLLEUCYLLEUCYLGLYCYLTHREONYLPHENYLALANYLASPARTYLTHREONYLARGINYLASPARAGINYLARGINYLISOLEUCYLISOLEUCYLGLUTAMYLVALYLGLUTAMYLASPARAGINYLGLUTAMINYLGLUTAMINYLSERYLPROLYLTHREONYLTHREONYLALANYLGLUTAMYLTHREONYLLEUCYLASPARTYLALANYLTHREONYLARGINYLARGINYLVALYLASPARTYLASPARTYLALANYLTHREONYLVALYLALANYLISOLEUCYLARGINYLSERYLALANYLASPARAGINYLISOLEUCYLASPARAGINYLLEUCYLVALYLASPARAGINYLGLUTAMYLLEUCYLVALYLARGINYLGLYCYLTHREONYLGLYCYLLEUCYLTYROSYLASPARAGINYLGLUTAMINYLASPARAGINYLTHREONYLPHENYLALANYLGLUTAMYLSERYLMETHIONYLSERYLGLYCYLLEUCYLVALYLTRYPTOPHYLTHREONYLSERYLALANYLPROLYLALANYLSERINE = Tobacco Mosaic Virus, Dahlemense Strain.
This word has appeared in the American Chemical Society's Chemical Abstracts and is thus considered by some to be the longest real word.

(39) TETRAMETHYLDIAMINOBENZHYDRYLPHOSPHINOUS = a type of acid.
This is the longest chemical term in the Oxford English Dictionary (2nd Ed.). It does not have its own entry but appears under a citation for another word.

(37) FORMALDEHYDETETRAMETHYLAMIDOFLUORIMUM
Chemical term in the Oxford English Dictionary (2nd Ed.).

(37) DIMETHYLAMIDOPHENYLDIMETHYLPYRAZOLONE
Chemical term in the Oxford English Dictionary (2nd Ed.).

(31) DICHLORODIPHENYLTRICHLOROETHANE = a pesticide used to kill lice; abbrv. DDT.
It is the longest word in the Macquarie Dictionary and is also in the Oxford English Dictionary (2nd Ed.).

(29) TRINITROPHENYLMETHYLNITRAMINE = a type of explosive.
This is the longest chemical term in Webster's Dictionary (3rd Ed.).

(27) ETHYLENEDIAMINETETRAACETATE
The longest unhyphenated word in Merriam-Webster's Collegiate Dictionary (10th Ed.), joint with electroencephalographically (see above).

(26) ETHYLENEDIAMINETETRAACETIC = a type of acid; abbrv. EDTA.
This word appears in Merriam-Webster's Collegiate Dictionary (10th Ed.).

Place Names

There are many long place names around the world. Here are a few of the largest.

(85) TAUMATAWHAKATANGIHANGAKOAUAUOTAMATEATURIPUKAKAPIKIMAUNGAHORONUKUPOKAIWHENUAKITANATAHU
A hill in New Zealand. This Maori name was in general use, but is now generally abbreviated to Taumata. The name means: the summit of the hill, where Tamatea, who is known as the land eater, slid down, climbed up and swallowed mountains, played on his nose flute to his loved one.

(66) GORSAFAWDDACHAIDRAIGODANHEDDOGLEDDOLONPENRHYNAREURDRAETHCEREDIGION
A town in Wales. The name means: the Mawddach station and its dragon teeth at the Northern Penrhyn Road on the golden beach of Cardigan bay.

(58) LLANFAIRPWLLGWYNGYLLGOGERYCHWYRNDROBWLLLLANTYSILIOGOGOGOCH
A town in North Wales. The name roughly translates as: St. Mary's Church in the hollow of the white hazel near to the rapid whirlpool of Llantysilio of the red cave. It is listed in the Guinness Book of World Records.

(41) CHARGOGAGOGMANCHARGOGAGOGCHARBUNAGUNGAMOG
Another name for Lake Webster in Massachusetts. Probably the longest name in the United States. Alternative spellings are:
(44) CHARGOGGAGOGGMANCHAUGGAGOGGCHAUBUNAGUNGAMOGG,
(45) CHARGOGGAGOGGMANCHAUGGAGOGGCHAUBUNAGUNGAMAUGG,
(44) CHARGOGGAGOGGMANCHAUGGAGOGGCHABUNAGUNGAMAUGG.

(23) NUNATHLOOGAGAMIUTBINGOI
The Eskimo name for some dunes in Alaska, according to The Book of Names by J. N. Hook. ........................one of these....ok, so stop ur arguing

Re: Longest word in the dictionary

ilikerps — Wed, 23 Feb 2005 02:21:33 GMT

A shortened version of some of the longer words in the dictionary.
Number of characters in parentheses before word.

>>>CHEMICAL:
(1,185) ACETYLSERYLTYROSYLSERYLISOLEUCYLTHREONYLSERYLPROLYLSERYLGLUTAMINYLPHENYLAL
ANYLVALYLPHENYLALANYLLEUCYLSERYLSERYLVALYLTRYPTOPHYLALANYLASPARTYLPROLYLISO
LEUCYLGLUTAMYLLEUCYLLEUCYLASPARAGINYLVALYLCYSTEINYLTHREONYLSERYLSERYLLEUCY
LGLYCYLASPARAGINYLGLUTAMINYLPHENYLALANYLGLUTAMINYLTHREONYLGLUTAMINYLGLUTA
MINYLALANYLARGINYLTHREONYLTHREONYLGLUTAMINYLVALYLGLUTAMINYLGLUTAMINYLPHENY
LALANYLSERYLGLUTAMINYLVALYLTRYPTOPHYLLYSYLPROLYLPHENYLALANYLPROLYLGLUTAMINY
LSERYLTHREONYLVALYLARGINYLPHENYLALANYLPROLYLGLYCYLASPARTYLVALYLTYROSYLLYSY
LVALYLTYROSYLARGINYLTYROSYLASPARAGINYLALANYLVALYLLEUCYLASPARTYLPROLYLLEUCY
LISOLEUCYLTHREONYLALANYLLEUCYLLEUCYLGLYCYLTHREONYLPHENYLALANYLASPARTYLTHRE
ONYLARGINYLASPARAGINYLARGINYLISOLEUCYLISOLEUCYLGLUTAMYLVALYLGLUTAMYLASPAR
AGINYLGLUTAMINYLGLUTAMINYLSERYLPROLYLTHREONYLTHREONYLALANYLGLUTAMYLTHREON
YLLEUCYLASPARTYLALANYLTHREONYLARGINYLARGINYLVALYLASPARTYLASPARTYLALANYLTHR
EONYLVALYLALANYLISOLEUCYLARGINYLSERYLALANYLASPARAGINYLISOLEUCYLASPARAGINYL
LEUCYLVALYLASPARAGINYLGLUTAMYLLEUCYLVALYLARGINYLGLYCYLTHREONYLGLYCYLLEUCYL
TYROSYLASPARAGINYLGLUTAMINYLASPARAGINYLTHREONYLPHENYLALANYLGLUTAMYLSERYLM
ETHIONYLSERYLGLYCYLLEUCYLVALYLTRYPTOPHYLTHREONYLSERYLALANYLPROLYLALANYLSER
INE
>>It is a Tobacco Mosaic Virus, Dahlemense Strain.
>>Although, a DNA strand could be millions of letters long, just to describe it.

>>>WORD:
(45) PNEUMONOULTRAMICROSCOPICSILICOVOLCANOCONIOSIS
>>It is a lung disease caused by breathing in particles of siliceous volcanic dust.
>>But it is many times thought of as an excuse for a long word :p

>>>LOCATION:
(85) TAUMATAWHAKATANGIHANGAKOAUAUOTAMATEATURIPUKAKAPIKIMAUNGAHORONUKUPOKAIWHENUAKITANATAHU
>>It is a hill in New Zealand.
>>I would hate to have to tell that one to everyone I see.

>>IN THE UNITED STATES:
(41) CHARGOGAGOGMANCHARGOGAGOGCHARBUNAGUNGAMOG
>>It is another name for Lake Webster in Massachusetts
>>Not as long as the previous, but it is in the United States. Like that matters.

Re: Longest word in the english language?

seyfihoca — Sat, 22 Jan 2005 10:31:52 GMT

and to sum up:

THE LONGEST WORDS IN ENGLISH

â¢ According to the Guinness Book of World Records, 18th edition, the following word is the longest chemical word for C1289H2051N343O375S8. Methionylglutaminy...serine is a scientific name for tryptophan synthetase, which is made up of 267 amino acids. It has appeared written down a number of times and has 1,909 letters.
The full name is:
methionylglutaminylarginyltyrosylglutamylserylleucylphenylalanylalanylglutaminylleucyllysylglutamylarginy

llysylglutamylglycylalanylphenylalanylvalyl

prolylphenylalanylvalylthreonylleucylglycylaspartylprolylglycylisoleucylglutamylglutaminylserylleucyllysyl

isoleucylaspartylthreonylleucylisoleucylglutamylalanylglycylalanylaspartylalanylleucylglutamylleucylglycyl

isoleucylprolylphenylalanylserylaspartylprolylleucylalanylaspartylglycylprolylthreonylisoleucylglutaminyla

sparaginylalanylthreonylleucylarginylalanylphenylalanylalanylalanylglycylvalylthreonylprolylalanylglutamin

ylcysteinylphenylalanylglutamylmethionylleucylalanylleucylisoleucylarginylglutaminyllysylhistidylprolylthre

onylisoleucylprolylisoleucylglycylleucylleucylmethionyltyrosylalanylasparaginylleucylvalylphenylalanylasp

araginyllysylglycylisoleucylaspartylglutamylphenylalanyltyrosylalanylglutaminylcysteinylglutamyllysylvalyl

glycylvalylaspartylserylvalylleucylvalylalanylaspartylvalylprolylvalylglutaminylglutamylserylalanylprolylph

enylalanylarginylglutaminylalanylalanylleucylarginylhistidylasparaginylvalylalanylprolylisoleucylphenylala

nylisoleucylcysteinylprolylprolylaspartylalanylaspartylaspartylaspartylleucylleucylarginylglutaminylisoleu

cylalanylseryltyrosylglycylarginylglycyltyrosylthreonyltyrosylleucylleucylserylarginylalanylglycylvalylthre

onylglycylalanylglutamylasparaginylarginylalanylalanylleucylprolylleucylasparaginylhistidylleucylvalylala

nyllysylleucyllysylglutamyltyrosylasparaginylalanylalanylprolylprolylleucylglutaminylglycylphenylalanylg

lycylisoleucylserylalanylprolylaspartylglutaminylvalyllysylalanylalanylisoleucylaspartylalanylglycylalanyla

lanylglycylalanylisoleucylserylglycylserylalanylisoleucylvalyllysylisoleucylisoleucylglutamylglutaminylhisti

dylasparaginylisoleucylglutamylprolylglutamyllysylmethionylleucylalanylalanylleucyllysylvalylphenylalany

lvalylglutaminylprolylmethionyllysylalanylalanylthreonylarginylserine

â¢ pneumonoultramicroscopicsilicovolcanoconiosis (a lung disease caused by the inhalation of
â¢ Honorificabilitudinitatibus
â¢ Supercalifragilisticexpialidocious
â¢ contraneoantidisestablishmentarianalistically
â¢ The technical term for "Tobacco Mosaic Virus, Dahlemense Strain" is the current official longest word:
â¢ Antidisestablishmentarianism (a movement opposed to the separation of church and state)
o -disestablishment- - the separation of Church and State (specifically in this context it is the political movement of the 1860s in Great Britain)
o disestablishment-arian - a person in support of the movement designed to bring about the above (hereafter called the 'first' movement).
o anti-disestablishment-arian - a person belonging to the movement opposed to the first movement.
o neo-anti-disestablishment-arian - a person belonging to the new version of the movement opposed to the first movement. (Appropriate because in this context the original antidisestablishment movement had become defunct).
o contra-neo-anti-disestablishment-arian - a person belonging to the movement opposed to the new version of the movement opposed to the first movement.
o contra-neo-anti-disestablishment-arian-alistically - behaving in the manner of a person belonging to the movement opposed to the new version of the movement opposed to the first movement.
o pseudo-contra-neo-anti-disestablishment-arian-alistically - false behaviour in the manner of a person belonging to the movement opposed to the new version of the movement opposed to the first movement.
o pro-pseudo-contra-neo-anti-disestablishment-arian-alistically - in favour of the false behaviour in the manner of a person belonging to the movement opposed to the new version of the movement opposed to the first movement.
â¢ Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwhenuakitanatahu (85 letters) which is a hill in New Zealand.
â¢ Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch is the famous name of a town in Wales in the United Kingdom.
â¢ The longest station name in the UK, at 68 letters, is: Gorsafawddacha'idraigodanheddogleddollÃ´npenrhynareurdraethceredigion which was contrived to beat the Welsh Town.
â¢ The longest place name in the United States (45 letters) is Chargoggagoggmanchauggagoggchaubunagungamaugg.
â¢ The longest hyphenated name in the U.S. is Winchester-on-the-Severn, a town in Maryland.
â¢ Hippopotomonstrosesquippedaliophobia - is the fear of long words (36 letters long).
â¢ Bababadalgharaghtakamminarronnkonnbronntonnerronntuonnthunntrovarrhounawnskawntoohoohoordenenthurnuk. Appearing on the first page, it allegedly is the symbolic thunderclap representing the fall of Adam and Eve.
â¢ "Twoallbeefpattiesspecialsaucelettucecheesepicklesonionsonasesameseedbun" was used in a McDonald's Restaurant advertisement.
â¢ Floccinaucinihilipilification is the act or habit of esteeming or describing something as worthless, or making something to be worthless by said means.
â¢ sesquipedalianism means "the practice of using words one and half feet long".
â¢ otorhinolaryngological (22 letters),
immunoelectrophoretically (25 letters),
psychophysicotherapeutics (25 letters),
thyroparathyroidectomized (25 letters),
pneumoencephalographically (26 letters),
radioimmunoelectrophoresis (26 letters),
psychoneuroendocrinological (27 letters)
hepaticocholangiogastrostomy (28 letters),
spectrophotofluorometrically (28 letters),
pseudopseudohypoparathyroidism (30 letters).
â¢ In Voltaire's Candide, Pangloss is supposed to have given lectures on metaphysico-theologo-cosmonigology (34 letters).
â¢ Greek words, and the Latin equivalents; osteosarchaematosplanchnochondroneuromuelous (44 letters) and osseocarnisanguineoviscericartilaginonervomedullary (51 letters), which translate roughly as 'of bone, flesh, blood, organs, gristle, nerve, and marrow'.
â¢ praetertranssubstantiationalistically (37 letters), used in Mark McShane's Untimely Ripped (1963), and aequeosalinocalcalinoceraceoaluminosocupreovitriolic (52 letters), attributed to Dr Edward Strother (1675-1737).
â¢ The formal names of chemical compounds are almost unlimited in length (for example, aminoheptafluorocyclotetraphosphonitrile, 40 letters).
â¢ Pneumonoultramicroscpicsilicovolcanoconiosis
â¢ Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwe
â¢ Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudo

mrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit
in Thailand which is a whopping 163 characters long so long that it doesn't even fit on one line! However whilst the New Zealand place name is recognised by the Guiness Book of Record, the Thailand name is not.
â¢ fluvialgeomorphologicaldendrochronology

in turkish we have: hassasiyetsizlestiriveremeyebileceklerimizdenmisiniz

which more or less means "are you from those whom we will not be able to make sensitive to ...?

Re: Longest word in the english language?

Rosetta — Sun, 05 Dec 2004 16:14:21 GMT

Well..well.well..
Guys!!!!

I don't even try to read those long words, nor count the letters, I trust all of you while saying the number of the letters!!

There were so much repititions there,I guess that everyone wants to post HIS word, not caring that others have suggested it before :D

Re: Longest word in the English language?

Guest — Wed, 06 Oct 2004 03:11:46 GMT

Theoretically couldn't you just name every number from one to infinity and eventually you will get words longer than any others.

Re: longest English word

Guest — Fri, 24 Sep 2004 03:00:25 GMT

for the guy who said think of the largest number u can think of and multiply it by 9999999999999, and write it in words, the answer would be infinity, and infinity isn't a very big word. but i do have another idea. put the number for pi (3.1427..........) in words! therefore, that would be the longest word because knowing that pi is irrational, it will never end!

Re: Longest word in the English language?

Guest — Fri, 07 May 2004 21:13:15 GMT

Do numbers count (pun intended) ?

... 99999999999999999999999999999999999999999999999999 ...

Re: Longest word in the English language?

lovedoctx — Mon, 05 Apr 2004 15:26:22 GMT

Ok, this is to set all records (that I know of) straight

-------------Longest Chemical Word-------------------------
methionylglutaminylarginyltyrosylglutamylserylleucylphenylalanylalanyl- glutaminylleucyllysylglutamylarginyllysylglutamylglycylalanylphenylalanyl- valylprolylphenylalanylvalylthreonylleucylglycylaspartylprolylglycyl- isoleucylglutamylglutaminylserylleucyllysylisoleucylaspartylthreonylleucyl- isoleucylglutamylalanylglycylalanylaspartylalanylleucylglutamylleucyl- glycylisoleucylprolylphenylalanylserylaspartylprolylleucylalanylaspartyl- glycylprolylthreonylisoleucylglutaminylasparaginylalanylthreonylleucyl- arginylalanylphenylalanylalanylalanylglycylvalylthreonylprolylalanyl- glutaminylcysteinylphenylalanylglutamylmethionylleucylalanylleucyl- isoleucylarginylglutaminyllysylhistidylprolylthreonylisoleucylprolyl- isoleucylglycylleucylleucylmethionyltyrosylalanylasparaginylleucylvalyl- phenylalanylasparaginyllysylglycylisoleucylaspartylglutamylphenylalanyl- tyrosylalanylglutaminylcysteinylglutamyllysylvalylglycylvalylaspartylseryl- valylleucylvalylalanylaspartylvalylprolylvalylglutaminylglutamylseryl- alanylprolylphenylalanylarginylglutaminylalanylalanylleucylarginylhistidyl- asparaginylvalylalanylprolylisoleucylphenylalanylisoleucylcysteinylprolyl- prolylaspartylalanylaspartylaspartylaspartylleucylleucylarginylglutaminyl- isoleucylalanylseryltyrosylglycylarginylglycyltyrosylthreonyltyrosylleucyl- leucylserylarginylalanylglycylvalylthreonylglycylalanylglutamylasparaginyl- arginylalanylalanylleucylprolylleucylasparaginylhistidylleucylvalylalanyl- lysylleucyllysylglutamyltyrosylasparaginylalanylalanylprolylprolylleucyl- glutaminylglycylphenylalanylglycylisoleucylserylalanylprolylaspartyl- glutaminylvalyllysylalanylalanylisoleucylaspartylalanylglycylalanylalanyl- glycylalanylisoleucylserylglycylserylalanylisoleucylvalyllysylisoleucyl- isoleucylglutamylglutaminylhistidylasparaginylisoleucylglutamylprolyl- glutamyllysylmethionylleucylalanylalanylleucyllysylvalylphenylalanylvalyl- glutaminylprolylmethionyllysylalanylalanylthreonylarginylserine

Scientific name for tryptophan synthetase, which is made up of 267 amino acids. It has appeared written down a number of times and has 1,909 letters. Chemical word for C1289H2051N343O375S8

-------------------Longest Word Found In Dictionary-----------------------
PNEUMONOÂULTRAÂMICROÂSCOPICÂSILICOÂVOLCANOÂCONIOSIS

a lung disease caused by breathing in particles of siliceous volcanic dust. Has 45 letters

------------------Longest Place Name----------------------------
TAUMATAÂWHAKAÂTANGIÂHANGAÂKOAUAUÂOÂTAMATEAÂTURIPUKAKAÂPIKIÂMAUNGAÂHOROÂNUKUÂPOKAIÂWHENUAÂKITANAÂTAHU

A hill in New Zealand. This Maori name was in general use, but is now generally abbreviated to Taumata. Has 85 Letters.

------------------Longest Internet Domain Name----------------
www.llanfairpwllgwyngyllgogerychwyrndrobwyll-llantysiliogogogoch.com

Not really a word but I thought it might be interesting to some people out there.

Re: Longest word in the English language?

Guest — Thu, 18 Mar 2004 03:54:21 GMT

The longest word in history is.....

Ornicopythebibliopsychocrystarroscioaerogenethleometeoroaustrohieroanthropoichthyopyrosiderochpnomyoalectryoophiobotanopegohydrorhabdocrithoaleurophitohalomolybdoclerobeloaxinacoscinodactylogeolithopessppsephocatoptrotephraonierochiroonychodactyloarithstichooxogeloscogastrogyrocerobletonooenoscapulinaniac
--- Medieval scribes this word to refer to "A deluted human who practices divinationor forecasting by means of phenomena, interpreting of acts, orother manifestations related to the following animate or inatimateobjects and appearences:birds, oracled, Bible, ghosts, crystal gazing, shadows, air appearences, birth stars, meteors, sacrificial appearences, entrails of humans and fishes, fire, red-hot iron, altar smoke, mice, grain picking by rooster, snakes, herbs, fountains, water, wands, dough, meal, barley, salt, lead, dice, arrows, hatchet balance, sieve, ring suspension, random dots, precious stones pebbles pebble heaps, mirrors, ash writing, dreams, palmistry, nail rays, finger rings, numbers, book passages, name letterings, laughing manners, vintriloquisim, circle walking, wax, susceptibility to hidden springs, wine, and shoulder blades.

Re: Longest word in the English language?

Guest — Sun, 22 Feb 2004 02:41:03 GMT

I don't understand how people that can post words with over 1000 letters can't read :s

Why do people claim to have the longest word, eg with less than 30 letters, when there are clearly much larger words in the language.

If people are claiming that chemical formulas are the longest words...sadly, they are wrong.

Can someone please write down the largest number they can think of, multiply it by itself 999999999999999999 times, and write down, IN A WORD, that number.

I think it will be consiberably higher than any "words" posted here...

Gary-Scotland (aged 15)