did you know the longest name of any country is ( local long form) Al Jumahiriyah al Arabiyah al Libiyah ash Shabiyah al Ishtirakiyah al Uzma (63 english letters) for LIBYA!
the second comes Al Jumhuriyah al Jaza'iriyah ad Dimuqratiyah ash Sha'biyah (51) for ALGERIA and third isItyop'iya Federalawi Demokrasiyawi Ripeblik 40 for ETHIOPIA!
1 2 3 4
Any ideas about the country that has the shortest name?
Chad, Peru, Laos... is there one with 3 letters? (without using abbreviations)
no idea!! but theres a place called "Leh" in Sikkim
Students: We have free audio pronunciation exercises.
Does it have an English Translation? What does it mean?
The longest name of a town in the world is the Welsh town Llanfairpwllgwyngyllgogerychwyrndrobwll Llantysiliogogogoch
It means "whose name means St Mary's church in the hollow of the white hazel near a rapid whirlpool and the Church of St Tysilio of the red cave"
Teachers: We supply a list of EFL job vacancies
AnonymousThe longest name of a town in the world is the Welsh town Llanfairpwllgwyngyllgogerychwyrndrobwll Llantysiliogogogoch
It means "whose name means St Mary's church in the hollow of the white hazel near a rapid whirlpool and the Church of St Tysilio of the red cave"
Lol... I can't trust that... Emotion: stick out tongue
Longest name of a place:

1. The official name of Bangkok, Thailand: Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit


krungthep mahanakorn
The great city of angels,

amorn rattanakosin mahintara yutthaya mahadilok phop
the supreme unconqueralble land of the great immortal divinity (Indra),

noparat rajathani burirom
the royal capital of nine noble gems, the pleasant city,

udomrajaniwes mahasatharn
with plenty of grand royal palaces,

amorn phimarn avatarnsathit
and divine paradises for the reincarnated deity (Vishnu),

sakkatattiya visanukam prasit
given by Indra and created by the god of crafting (Visnukarma).
2. Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu (New Zealand's South Island)

Translation: "The place where Tamatea, the man with the big knees, who slid, climbed, and swallowed mountains, known as land eater, played his flute to his loved one"

3. Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch (North Wales)

Translation: "Saint Mary's Church in the hollow of white hazel near a rapid whirlpool and the Church of Saint Tysilio near the red cave."

Apparently http://llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk / is the longest domain name on the web. Locals call it Llanfair PG or Llanfairpwll.


Shortest name of a place:

1. A (Norway)

It's actually A with a circle on top, pronounced like 'or' in 'port'. It's an old Norwegian word for river, and the last alphabet in Norwegian. It's a tiny fishing hamlet in the Lofoten Islands.

2. Y (France)

Pronounced as E. Y is near the township of Ham ans Athies in the department of Somme in Picardy.
Try out our live chat room.
Show more